PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim05g049860.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 102aa    MW: 11854.5 Da    PI: 10.8325
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim05g049860.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like46.77.1e-151061356
             G2-like  3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56
                        r++Wtp+  ++F ea+++LG  ekAt   ile m+v+ Lt+++v   LQ+YR++
  Sopim05g049860.0.1 10 RIKWTPNVNKKFNEAIRRLG--EKATAIPILEYMNVPQLTRKQVENRLQQYRVH 61
                        99*****************6..5566666***********************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-15661IPR009057Homeodomain-like
SuperFamilySSF466891.7E-10762IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-121062IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 102 aa     Download sequence    Send to blast
MEERKERRLR IKWTPNVNKK FNEAIRRLGE KATAIPILEY MNVPQLTRKQ VENRLQQYRV  60
HQLAQHASSS SSLVLANPPN VLNSHDELQH TCNNTFFSST R*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755171e-107HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLK4C1193e-70K4C119_SOLLC; Uncharacterized protein
STRINGSolyc05g049860.1.18e-70(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA2809322
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18240.33e-10myb-related protein 1